PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr033618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 369aa    MW: 40930.9 Da    PI: 4.5714
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr033618.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++lv ++++ G ++W++ +r+ g+ R++k+c++rw +yl
      Pbr033618.1 17 RGPWSPAEDLKLVTYIQKNGHHNWRALPRRAGLMRCGKSCRLRWINYL 64
                     89********************************************97 PP

2Myb_DNA-binding51.52.3e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e + ++++ lG++ W+tIa++++ gRt++++k+ w+++l
      Pbr033618.1  70 RGNFTREEEESIMKLHEALGNK-WSTIAAHFP-GRTDNEIKNVWNTHL 115
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0251264IPR017930Myb domain
SuperFamilySSF466891.39E-2815111IPR009057Homeodomain-like
SMARTSM007171.6E-101666IPR001005SANT/Myb domain
PfamPF002495.7E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-221871IPR009057Homeodomain-like
CDDcd001674.27E-91964No hitNo description
PROSITE profilePS5129424.14665119IPR017930Myb domain
SMARTSM007173.6E-1369117IPR001005SANT/Myb domain
PfamPF002492.2E-1470115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2672119IPR009057Homeodomain-like
CDDcd001673.18E-972115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGEKGKSLCC DKEQVRRGPW SPAEDLKLVT YIQKNGHHNW RALPRRAGLM RCGKSCRLRW  60
INYLSPDVKR GNFTREEEES IMKLHEALGN KWSTIAAHFP GRTDNEIKNV WNTHLKKRLA  120
CRNLSSLTSS SSSSSSTTTT TTLLSSGKPT VGGGDELIEH QSADQETSMA TNNKPHEPCS  180
LTIQENPNHQ DSPMELTNDP KGLKELTTSS NVSSNESNGS SNSSQVVGMS RPGAEEQQMD  240
DDLIDLSGIF DNPFHESDSD FWNMLDDFQP LQSNEVQVLH EADEANYQSS GLGQVENGNW  300
LSYLQNELGF EAAATESEIN NQEILPKGAT EQPVIPETFD KMPNPAGYDE SMDYFQTWLS  360
SPENNSAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-24171194105C-Myb DNA-Binding Domain
1msf_C4e-24171194105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341729.10.0PREDICTED: myb-related protein 308-like
TrEMBLM5WMX01e-123M5WMX0_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.12e-64myb domain protein 58